PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_016649182.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Amygdaleae; Prunus
Family NAC
Protein Properties Length: 681aa    MW: 77233.8 Da    PI: 5.45
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_016649182.1genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM181.62e-5661331128
             NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp.k.kvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevl 93 
                     lppGfrFhPtdeelv +yLk+k++g+k+el evi+evd+yk+ePwdLp k  + +++ ewyfFs+rd+ky++g+r+nratk+gyWkatgkd++v 
  XP_016649182.1   6 LPPGFRFHPTDEELVAYYLKRKINGRKIEL-EVIPEVDLYKCEPWDLPgKsLLPSKDLEWYFFSPRDRKYPNGSRTNRATKAGYWKATGKDRKVN 99 
                     79****************************.99***************6434555777************************************* PP

             NAM  94 skkgelvglkktLvfykgrapkgektdWvmheyrl 128
                     s ++++vg+kktLv+y+grap+g +tdWvmheyrl
  XP_016649182.1 100 S-QTRAVGMKKTLVYYRGRAPHGIRTDWVMHEYRL 133
                     *.9999***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019416.93E-654156IPR003441NAC domain
PROSITE profilePS5100561.9976156IPR003441NAC domain
PfamPF023657.4E-307133IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 681 aa     Download sequence    Send to blast
MAPVSLPPGF RFHPTDEELV AYYLKRKING RKIELEVIPE VDLYKCEPWD LPGKSLLPSK  60
DLEWYFFSPR DRKYPNGSRT NRATKAGYWK ATGKDRKVNS QTRAVGMKKT LVYYRGRAPH  120
GIRTDWVMHE YRLDERECET AQGLQDAYAL CRIFKKSATG PKIGEHYGST STTNYQLTSD  180
HSSSVELYSD GGRCEDFESS SYPMQMNACS SSPNFVHTSS LDMARKRDGK WTQFLSKDAF  240
NCSSSFSSFP NHGNVPYPPS KVDIALECAR LQHRLSLPPL EVEDFPRVGL NDFKTMQYSN  300
PAVEPTSTET DALQEILSVA HVSQEMINQS SNLADQTWGG NYAAPANDFS FIVDRDAHYN  360
QITDHMNSMR YVEKSWENPY TRSIEIGDLE DDFRMENTAE NLRWVGISDK YLEKSFMEEN  420
KVVPLENISS FQREEQEHEV QVAGEIGDQS GMIKEFNDSE TNDDFSLGFI NEDPNDNFLN  480
DGTMDDYSPS PSFEVIEEIQ VNHGMFVSTR QVAETFFHQL MPSQTVKVHL NPALGQNFFV  540
ERVDTQTKCE NIGSFFESFK AFGMDKFVGV SKSTKPWRKV ASTLVCAVTL LLMHIIYFGQ  600
HVEDEKLMDA FTSTTTAAIV EEKGNSNVSK KKKGLGLIKW SNKEEKVCLV NIRGGNSCSV  660
LLKKIGVFLT VSLALCTMWA L
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A9e-57215611168Stress-induced transcription factor NAC1
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00212DAPTransfer from AT1G65910Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008227899.10.0PREDICTED: uncharacterized protein LOC103327366
TrEMBLM5XAW60.0M5XAW6_PRUPE; Uncharacterized protein
STRINGVIT_04s0079g00280.t010.0(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF44213460
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G65910.11e-167NAC domain containing protein 28